PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sevir.1G351600.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria
Family MYB
Protein Properties Length: 397aa    MW: 41603.5 Da    PI: 7.3106
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sevir.1G351600.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding49.11.3e-151462148
                        TSSS-HHHHHHHHHHHHHTTTT.-HHHHHHHHTTTS-HHHHHHHHHHHT CS
     Myb_DNA-binding  1 rgrWTteEdellvdavkqlGgg.tWktIartmgkgRtlkqcksrwqkyl 48
                        +g+W++eEd +l+ ++++ G+g +W + ++++g++R++k+c++rw++yl
  Sevir.1G351600.1.p 14 KGPWSPEEDAKLKAYIEENGTGgNWIALPQKIGLKRCGKSCRLRWLNYL 62
                        79*********************************************97 PP

2Myb_DNA-binding38.72.3e-1269111246
                         SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
     Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                         g +T+eE+ ++  +    G++ W+ Ia+ ++ gRt++++k++w++
  Sevir.1G351600.1.p  69 GDFTEEEEHIICSLYISIGSR-WSIIAAQLP-GRTDNDIKNYWNT 111
                         789******************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129414.093962IPR017930Myb domain
SuperFamilySSF466895.86E-2611109IPR009057Homeodomain-like
SMARTSM007173.7E-121364IPR001005SANT/Myb domain
PfamPF002499.3E-151462IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.609.8E-241569IPR009057Homeodomain-like
CDDcd001674.21E-91662No hitNo description
PROSITE profilePS5129421.92463117IPR017930Myb domain
SMARTSM007172.9E-1067115IPR001005SANT/Myb domain
PfamPF002495.0E-1169111IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.2E-2270117IPR009057Homeodomain-like
CDDcd001676.72E-771111No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 397 aa     Download sequence    Send to blast
MGRAPCCDKA SVKKGPWSPE EDAKLKAYIE ENGTGGNWIA LPQKIGLKRC GKSCRLRWLN  60
YLRPNIKHGD FTEEEEHIIC SLYISIGSRW SIIAAQLPGR TDNDIKNYWN TKLKKKLLGK  120
RAPSRRARAN HQDPYLAAAG GNMCSTSGGG GVNNGGSATA AATPQALSAS ALERIQLHMR  180
LQGLYGAFGG CSNNDNNAAA AAAPQWPKLE TLLQANKLLP GSLPTDAVAT TVSVQHPPQQ  240
HLVEQSLAGV GAGTAVVEAA EQQLSSAAGA NYMAAAGSFE RPSKLGFYSP SAEAEAASAE  300
MMGGYGGAGS FGSHHDELYE FLYSKYGSLG GGVAAQGGHI PPLPELHQCP DGAAADEKFS  360
TWTTASCDYG AAGHHQLQGN SIGGSLQDYV LGEYGQ*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A6e-25141177108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014660926.10.0PREDICTED: uncharacterized protein LOC101760334
SwissprotQ9FKL21e-89MYB36_ARATH; Transcription factor MYB36
TrEMBLK3YT200.0K3YT20_SETIT; Uncharacterized protein
STRINGSi017415m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP13538412
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G57620.16e-80myb domain protein 36